Sign In | Join Free | My chinaqualitycrafts.com
chinaqualitycrafts.com
Products
Search by Category
Home > Chemicals > Inorganic Salt > Nitrate >

Food Grade Sapp 28

food grade sapp 28

All food grade sapp 28 wholesalers & food grade sapp 28 manufacturers come from members. We doesn't provide food grade sapp 28 products or service, please contact them directly and verify their companies info carefully.

Total 6 products from food grade sapp 28 Manufactures & Suppliers
Best SAPP28--Sodium Acid Pyrophosphate 28 Food Grade wholesale

Categories:Nitrate

Telephone:0086-516-66655370, +86-516-83809353

Country/Region:china

Enlarge Image Browse similar products Product name: SAPP28--Sodium Acid Pyrophosphate 28 Food Grade Product Number: SAPP28 Time: 2011-01-25 Views 164 details Raw Material ...

Xuzhou hengxing chemical co., ltd
ICP Remarked Supplier

Jiangsu

Best Hetai Chemical Water-retention agent min 95% Sodium Acid Pyrophosphate SAPP Na2H2P2O7 from China wholesale

Brand Name:hetai

Model Number:food grade

Place of Origin:China

Name: Sodium Acid Pyrophosphate Appearance:white powder/crystal Grade:food grade Type:food additive Molecular formula: NaH2PO4 HS code:2835399000 CAS code:7588-16-9 Certificate:SGS...

Nanjing Hetai Chemical Co., Ltd
Site Member

Jiangsu

Best Sodium Acid Pyrophosphate(SAPP) wholesale

Place of Origin:Tianjin, China

Model Number:Na2H2P2O7

Sodium Acid Pyrophosphate (SAPP) food grade: CAS No.: 7758-16-9 COA: Items Specifications: Test Results Unit Na2H2P2O7 95.0 min 97.4 % P2O5 63~64.5 64.4 % Insoluble matter in water ...

Tianjin Yuanlong Chemical Industry Co., Ltd
Active Member

Tianjin

Best CJC - 1295 muscle building peptides With Dac , 2mg / Vial Fat Burning weight on powder 863288-34-0 wholesale

Brand Name:Bodybuilding

Model Number:863288-34-0

Place of Origin:China

CJC - 1295 muscle building peptides With Dac , 2mg / Vial Fat Burning weight on powder 863288-34-0 Product Descripition: Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier

Hunan

Best Sodium Acid Pyrophos... wholesale

Categories:Sodium Fluoride Crystal

Telephone:86-731-84763039

Country/Region:china

HOME >> Product Center>> Sodium Acid Pyrophos... Name: Sodium Acid Pyrophosphate Food Grade ( SAPP ) NO.: Sodium Acid Pyrophosphate Food Grade ( SAPP ) Type: Chemicals Detailed ...

Achievement Marketing International (AMI)
ICP Remarked Supplier

Best CJC - 1295 With DAC , 2mg / Vial Peptide Hormones Bodybuilding Fat Burning 	Peptide 863288-34-0 wholesale

Brand Name:Pharmagrade Steroids

Model Number:863288-34-0

Place of Origin:China

CJC - 1295 muscle building peptides With Dac , 2mg / Vial Fat Burning weight on powder 863288-34-0 Product Descripition: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D...

HUBEI PHARMAGRADE STEROIDS., LTD
Verified Supplier

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request