Sign In | Join Free | My chinaqualitycrafts.com
chinaqualitycrafts.com
Products
Search by Category

hgh athletes

All hgh athletes wholesalers & hgh athletes manufacturers come from members. We doesn't provide hgh athletes products or service, please contact them directly and verify their companies info carefully.

Total 3282 products from hgh athletes Manufactures & Suppliers
Quality Supply HGH (Human Growth Hormone), Hygetropin 100IU (10IU/Vial 10Vials/kit), Hygetropin manufacturers for sale

Brand Name:Hygetropin

Model Number:Hygetropin

Place of Origin:china

... in the body by the pituitary. By being identical in structure to the body's own hGH, there is no risk the body will create antibodies to Hygetropins Hormone consisting of 191...

Global chemicals Co.,Ltd
Verified Supplier

Quality Healthy Muscle Building Peptides 191AA Kigtropin Hgh Raw Powder CAS 96827-07-5 for sale

Brand Name:shinrezing

Model Number:96827-07-5

Place of Origin:China

Product Description Human Growth Supplements Kig Tropin Humatropin Hormone Model:WDHGH04 Specification:10iu/vial,10vial/box Other GH brand: Name Spe Kig 10iu/vial,10vial/box Jin 10iu/vial,10vial/box HUM 8iu/vial,25vial/box Nor 10iu/vial,10vial/box IG ...

Hubei Shinrezing Pharmaceutical Technology Co.,Ltd
Verified Supplier

Hubei

Quality GMP Certificated Hgh Human Growth Hormone For Muscle Mass Natural EPO Powder for sale

Brand Name:saizeng

Model Number:CasNo: 52170-72-6

Place of Origin:shanghai

...Bodybuilding Peptides For Muscle Mass EPO Powder GMP Certification jintroping hcg hgh 1. Company Info: Peak Biological Medicine Co., Ltd established in May.2012,which is a professional manufacturer ...

Linyi dingsheng chemical products Co., Ltd
Verified Supplier

Shandong

Quality Safety Muscle Building / Anti AgingNatural HGH Supplements injections for sale

Brand Name:HGH

Model Number:Red top hgh

Place of Origin:China

...Muscle Building HGH Supplement Human Growth Hormones For Anti Aging Is human growth hormone effective for anti aging? ...

HongKong Biosuper Health Tech. Co., Ltd
Verified Supplier

Hongkong

Quality CAS No 12629-01-5 Top Pure HGH Human Growth Hormone  Anti Aging Growth Hormone for sale

Brand Name:SGH

Model Number:CAS No: 12629-01-5

Place of Origin:China

Cas No. 12629-01-5 Size: 15iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

Jiangsu Biostronger Technology Co.,Ltd
Verified Supplier

Jiangsu

Quality Weight Loss HGH hormone original Hygetropin 200iu Human Growth Hormone fewer skin wrinkles for sale

Brand Name:Hygene Hygetropin 200iu

Model Number:10iu/vial, 100iu/box

Place of Origin:China

...: China Purity : 98.5% Color : white Lyophilized powder Standard: 10iu/vial, 100iu/box Human growth hormone (HGH) has been called a miracle anti-aging drug -- it's widely used in alternative clinics for the...

HongKong Amgen Biopharm CO.,LTD
Verified Supplier

Hong Kong

Quality Ghrp 6 HGH Human Growth Hormone 99% Purity Peptide Acetate For Bodybuilding for sale

Model Number:GHRP-6

...GHRP-6 99% Purity HGH Human Growth Hormone Peptide Acetate For Bodybuilding​ Detailed Product Description Appearance: Powder Purity: 99.9% Production ...

Hubei KUKE Chemcial Co., Ltd
Verified Supplier

Hubei

Quality Bodybuilding  HGH Fragement 176-191 2,5mg/vial Blue For Weight Loss for sale

Brand Name:YuanCheng

Model Number:HGH

Place of Origin:China

... 176-191 2,5mg/vial Blue For Weight Loss Quick Detail: 1. Name : HGH frag 176-191 , HGH Fragement , Peptides 2. Assay : 99% min 3 . Specification : 2,5mg/vial , blue top , red top 4. Shipping : All the ...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier

Hunan

Quality Natural Effictive HGH Growth Hormone Peptide for sale

Brand Name:HBU

Model Number:12629-01-5

Place of Origin:CHINA

...) Description HGH 99.7% It has anabolic effects, may increase muscular physique, but also for people in childhood and adolescence, bone growth, and strengthen the tendons and increase the internal organs. Athletes using...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Quality Bremelanotide PT-141 HGH Peptide Fragment , Body Building Peptides White Powder for sale

Brand Name:coco@yuanchengtech.com

Model Number:32780-32-8

Place of Origin:China

...Bremelanotide PT-141 HGH Peptide Fragment , Body Building Peptides White Powder Wuhan Lianshangwang Technology Co.,LTD Contact person:helena ...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hubei

Quality 99.8% Purity Jitropin HGH Human Growth Hormone Injections 10iu For Weight Loss for sale

Brand Name:HGH Human Growth Hormone

Place of Origin:China

...99.8% Purity Jitropin HGH Human Growth Steroids Hormone Powder 10iu for Weight Loss Introduction Human Growth Steroid Hormone is ...

Zhuhai jiacheng Sci. & Tech. Co., Ltd
Verified Supplier

Guangdong

Quality Recombinant HGH Human Growth Hormone IGF LR3 -1 for Gaining Muscle / Fat Loss for sale

Place of Origin:China(Mainland)

Brand Name:SUPER STEROIDS

Model Number:evelyn@chembj.com

Recombinant Human Growth Hormone IGF LR3 -1 for Gaining Muscle / Losing Fat Quick Details: IGF LR3 -1 Assay:97% Model:10iu/vial Package:10vial/kit Apperance:White Lyophilized powder. Manufacturer :Hezhong Usage : Losing Cellulite and Wrinkles,Gaining ...

Wuhan Hezhong Bio-Chemical Manufacture Co., Ltd.
Verified Supplier

Hubei

Quality Paypal China Wholesale Buy Somatropin Human Hgh Growth Hormone 10iu for sale

Brand Name:YIHAN

Model Number:12629-01-5

Place of Origin:China

...Paypal China Wholesale Buy Somatropin Human Hgh Growth Hormone 10iu Product Details: 10IU HGH WITH 1ML WATER USE FOR HGH PEN 5 PLECES IN A BOX WITH HGH PEN EINECS No.: 235-735-8 CAS : 12629-01...

Yihan Industrial Co.,Ltd.
Verified Supplier

Guangdong

Quality Muscle Building HGH Growth Hormone , Human Growth Hormone Anti Aging for sale

Place of Origin:China

Brand Name:Human Growth Hormones

Model Number:10iu/vial, 100iu/box

... supplements , HGH Growth Hormones for muscle building Quick Detail: Generic name: Recombinant Human Interferon alpha 2b for injection Trade name: Taitropin® Composition in effect: Recombinant Human Interferon alpha 2b. Description: Athletes using...

Hong Kong Super Hormone Pharma co., ltd
Verified Supplier

Hong Kong

Quality China Best Peptides Manufacturer Supply Medicine Grade HGH Fragment 176-191 Lyophilized Powder for sale

Brand Name:Kafen

Model Number:albert@kafenbio.com

Place of Origin:China

...Quick detials: HGH Frag 176-191 Freeze-dried powder Product Name: HG Frag 176-191 Synonyms: HG Fragment ...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Quality Weight Loss Peptides HGH Fragment 176-191, Injectable Fat Burning Supplements for sale

Brand Name:LSW

Model Number:HGH Fragment 176-191

Place of Origin:China

... at the C terminal region they could isolate the fat loss attributes associated with HGH. Taking this fragment from HGH, including the peptide bonds from 176-191, they found they had developed a peptide...

Wuhan Lianshangwang Technology Co.,Ltd
Verified Supplier

Hubei

Quality CAS 13103-34-9 HGH Human Growth Hormone Equipoise Boldenone Undecylenate Powder for sale

Brand Name:Rund

Model Number:CAS 13103-34-9

Place of Origin:China

Muscle Growth CAS 13103-34-9 Steroids Equipoise Boldenone Undecylenate Powder Details Boldenolone Undecylenate Alias:Boldenoneundecylenate,Boldenoneundec-10-enoate,17b-[(1-Oxo-10-undecenyl)oxy]-androsta-1,4-dien-3-one,17b-Hydroxyandrosta-1,4-dien-3-one10-...

3M Biotech Co., Ltd
Verified Supplier

Quality Erythropoietin(rhEPO) Powder Injection Recombinant Human Erythropoietin HGH Wholesale for sale

Place of Origin:Shen Zhen of China

Brand Name:Erythropoietin

Model Number:Whf@hkhanwei.com

Erythropoietin Introduction Erythropoietin (pronounced, ah-rith-ro-poy-tin, and abbreviated, EPO) is a relatively recent entry into the deceitful pursuit of glory. EPO is a protein hormone produced by the kidney. After being released into the blood stream...

Hongkong HW Biotech Co.,Ltd.
Site Member

Yunnan

Quality Clenbuterol/clen-60 is used by athletes and bodybuilders to maintain muscle mass while reducing body fat and weight for sale

Brand Name:CL

Place of Origin:CHINA

...Description: Clenbuterol (often called just “Clen”) is used by athletes and bodybuilders for it’s ability as a beta-2 agonist. It therefore stimulates your beta-2 receptors, which ...

Qingdao Manbo Trading Co.,Ltd
Site Member

Shandong

Quality Fragment 176-191 HGH Anabolic Steroids Hormones For Bodybuilding for sale

Brand Name:GB

Place of Origin:China

... youthful. But experts say that hope is unfounded. And worse, these products can be harmful. 2. HGH, produced by the pituitary gland, spurs growth in children and adolescents. It also helps to...

Hubei God bull Pharmaceutical Co.,Ltd
Site Member

Hubei

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request