Sign In | Join Free | My chinaqualitycrafts.com
chinaqualitycrafts.com
Products
Search by Category
Home > Chemicals > Chemical Stocks >

Hgh Athletes

hgh athletes

All hgh athletes wholesalers & hgh athletes manufacturers come from members. We doesn't provide hgh athletes products or service, please contact them directly and verify their companies info carefully.

Total 3332 products from hgh athletes Manufactures & Suppliers
Quality Muscle Mass Human Growth Peptides HGH Fragment 176-191 Cycle 2mg/Vial Powder for sale

Brand Name:YUANHANG

Model Number:HGH Fragment 176-191 Cycle 2mg/Vial

Place of Origin:CHINA

...Human Growth Peptides hgh fragment 176-191 cycle 2mg/Vial Powder for Muscle Mass YUANHANG Chemical Co.,Ltd., a leading ...

Yuanhang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Quality Recombinant Human Interferon alpha 2b Kigtropin Growth Hormone , HGH Elisa Kit for sale

Brand Name:Human Growth Hormone

Model Number:Kigtropin

Place of Origin:China

Kigtropin rhgh, Human Growth Hormone, Somatropin 191aa Kigtropin is one of the safest hormones any man or woman can administer to their body. This is not a foreign substance, it is a hormone your body is well accustomed to, and more importantly, one it ...

Global chemicals Co.,Ltd
Verified Supplier

Quality Hgh Supplement Hgh For Men HGH injections Hgh For Sale Bodybuilding for sale

Categories:Growth Hormone Peptides

Country/Region:china

...Hgh Supplement Hgh For Men HGH injections Hgh For Sale Bodybuilding Quick Details: Name: HGH Fragment 176-191 Molecular Formula:C78H123N23O23S2 Molecular Weight:1815.08 Appearance:white powder Purity (HPLC):≥...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Quality Healthy Raw Steroid Powders Durabolin For Athletes Long Acting Cas 2322-77-2 for sale

Brand Name:durabolin

Model Number:2322-77-2

Place of Origin:china

...Healthy Raw Steroid Powders Durabolin For Athletes Long Acting Cas 2322-77-2 Skype: live:6c01f49430a6f4d5 Skype :RC supplier Email : rcbossboy@gmail.com ...

Shandong Chuangrui Chemical Technology Co., Ltd.
Verified Supplier

Shandong

Quality Injectable 100iu HGH Human Growth Hormone Steroid Ansomone For Burning for sale

Brand Name:RX

Model Number:589

Place of Origin:China

... Growth Hormone Steroid Ansomone For Burning Ansomone Posted under: HGH (Human Growth Hormone) Ansomone – a popular high-quality drug, which main active substance is recombinant growth ...

HONGKONG RONGXIN BIO-TECH CO.,LTD
Verified Supplier

Shaanxi

Quality Healthy Muscle Building Peptides 191AA Kigtropin Hgh Raw Powder CAS 96827-07-5 for sale

Brand Name:shinrezing

Model Number:96827-07-5

Place of Origin:China

Product Description Human Growth Supplements Kig Tropin Humatropin Hormone Model:WDHGH04 Specification:10iu/vial,10vial/box Other GH brand: Name Spe Kig 10iu/vial,10vial/box Jin 10iu/vial,10vial/box HUM 8iu/vial,25vial/box Nor 10iu/vial,10vial/box IG ...

Hubei Shinrezing Pharmaceutical Technology Co.,Ltd
Verified Supplier

Hubei

Quality Safety Muscle Building / Anti AgingNatural HGH Supplements injections for sale

Brand Name:HGH

Model Number:Red top hgh

Place of Origin:China

...Muscle Building HGH Supplement Human Growth Hormones For Anti Aging Is human growth hormone effective for anti aging? ...

HongKong Biosuper Health Tech. Co., Ltd
Verified Supplier

Hongkong

Quality CAS No 12629-01-5 Top Pure HGH Human Growth Hormone  Anti Aging Growth Hormone for sale

Brand Name:SGH

Model Number:CAS No: 12629-01-5

Place of Origin:China

Cas No. 12629-01-5 Size: 15iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

Jiangsu Biostronger Technology Co.,Ltd
Verified Supplier

Jiangsu

Quality Weight Loss HGH hormone original Hygetropin 200iu Human Growth Hormone fewer skin wrinkles for sale

Brand Name:Hygene Hygetropin 200iu

Model Number:10iu/vial, 100iu/box

Place of Origin:China

...: China Purity : 98.5% Color : white Lyophilized powder Standard: 10iu/vial, 100iu/box Human growth hormone (HGH) has been called a miracle anti-aging drug -- it's widely used in alternative clinics for the...

HongKong Amgen Biopharm CO.,LTD
Verified Supplier

Hong Kong

Quality Ghrp 6 HGH Human Growth Hormone 99% Purity Peptide Acetate For Bodybuilding for sale

Model Number:GHRP-6

...GHRP-6 99% Purity HGH Human Growth Hormone Peptide Acetate For Bodybuilding​ Detailed Product Description Appearance: Powder Purity: 99.9% Production ...

Hubei KUKE Chemcial Co., Ltd
Verified Supplier

Hubei

Quality Natural Effictive HGH Growth Hormone Peptide for sale

Brand Name:HBU

Model Number:12629-01-5

Place of Origin:CHINA

...) Description HGH 99.7% It has anabolic effects, may increase muscular physique, but also for people in childhood and adolescence, bone growth, and strengthen the tendons and increase the internal organs. Athletes using...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Quality Recombinant HGH Human Growth Hormone IGF LR3 -1 for Gaining Muscle / Fat Loss for sale

Place of Origin:China(Mainland)

Brand Name:SUPER STEROIDS

Model Number:evelyn@chembj.com

Recombinant Human Growth Hormone IGF LR3 -1 for Gaining Muscle / Losing Fat Quick Details: IGF LR3 -1 Assay:97% Model:10iu/vial Package:10vial/kit Apperance:White Lyophilized powder. Manufacturer :Hezhong Usage : Losing Cellulite and Wrinkles,Gaining ...

Wuhan Hezhong Bio-Chemical Manufacture Co., Ltd.
Verified Supplier

Hubei

Quality 99.8% Purity Jitropin HGH Human Growth Hormone Injections 10iu For Weight Loss for sale

Brand Name:HGH Human Growth Hormone

Place of Origin:China

...99.8% Purity Jitropin HGH Human Growth Steroids Hormone Powder 10iu for Weight Loss Introduction Human Growth Steroid Hormone is ...

Zhuhai jiacheng Sci. & Tech. Co., Ltd
Verified Supplier

Guangdong

Quality Paypal China Wholesale Buy Somatropin Human Hgh Growth Hormone 10iu for sale

Brand Name:YIHAN

Model Number:12629-01-5

Place of Origin:China

...Paypal China Wholesale Buy Somatropin Human Hgh Growth Hormone 10iu Product Details: 10IU HGH WITH 1ML WATER USE FOR HGH PEN 5 PLECES IN A BOX WITH HGH PEN EINECS No.: 235-735-8 CAS : 12629-01...

Yihan Industrial Co.,Ltd.
Verified Supplier

Guangdong

Quality Jin / Hy / Kig Original HGH Human Growth Hormone Peptides Jintropin for sale

Brand Name:Mking

Model Number:CAS: 148031-34-9

Place of Origin:Hubei, China

...: Medicine Grade Appearance: White Lyophilized Powder Jintropin is a supplement containing human growth hormone that many athletes take in hopes of enhancing strength, agility and exercise performance. Other people take Jintropin

Hubei Mking Biotech Co., Ltd.
Verified Supplier

Hubei

Quality Muscle Building HGH Growth Hormone , Human Growth Hormone Anti Aging for sale

Place of Origin:China

Brand Name:Human Growth Hormones

Model Number:10iu/vial, 100iu/box

... supplements , HGH Growth Hormones for muscle building Quick Detail: Generic name: Recombinant Human Interferon alpha 2b for injection Trade name: Taitropin® Composition in effect: Recombinant Human Interferon alpha 2b. Description: Athletes using...

Hong Kong Super Hormone Pharma co., ltd
Verified Supplier

Hong Kong

Quality China Best Peptides Manufacturer Supply Medicine Grade HGH Fragment 176-191 Lyophilized Powder for sale

Brand Name:Kafen

Model Number:albert@kafenbio.com

Place of Origin:China

...Quick detials: HGH Frag 176-191 Freeze-dried powder Product Name: HG Frag 176-191 Synonyms: HG Fragment ...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Quality Erythropoietin(rhEPO) Powder Injection Recombinant Human Erythropoietin HGH Wholesale for sale

Place of Origin:Shen Zhen of China

Brand Name:Erythropoietin

Model Number:Whf@hkhanwei.com

Erythropoietin Introduction Erythropoietin (pronounced, ah-rith-ro-poy-tin, and abbreviated, EPO) is a relatively recent entry into the deceitful pursuit of glory. EPO is a protein hormone produced by the kidney. After being released into the blood stream...

Hongkong HW Biotech Co.,Ltd.
Site Member

Yunnan

Quality Clenbuterol/clen-60 is used by athletes and bodybuilders to maintain muscle mass while reducing body fat and weight for sale

Brand Name:CL

Place of Origin:CHINA

...Description: Clenbuterol (often called just “Clen”) is used by athletes and bodybuilders for it’s ability as a beta-2 agonist. It therefore stimulates your beta-2 receptors, which ...

Qingdao Manbo Trading Co.,Ltd
Site Member

Shandong

Quality Fragment 176-191 HGH Anabolic Steroids Hormones For Bodybuilding for sale

Brand Name:GB

Place of Origin:China

... youthful. But experts say that hope is unfounded. And worse, these products can be harmful. 2. HGH, produced by the pituitary gland, spurs growth in children and adolescents. It also helps to...

Hubei God bull Pharmaceutical Co.,Ltd
Site Member

Hubei

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request