Sign In | Join Free | My chinaqualitycrafts.com
chinaqualitycrafts.com
Products
Search by Category

hgh athletes

All hgh athletes wholesalers & hgh athletes manufacturers come from members. We doesn't provide hgh athletes products or service, please contact them directly and verify their companies info carefully.

Total 2010 products from hgh athletes Manufactures & Suppliers
Quality 99.9% Purity HGH Growth Hormone Muscle Building 191aa Hgh Pen GH Custom Service for sale

Brand Name:FILTER

Model Number:API

Place of Origin:China

...99.9% Purity Growth Hormone Muscle Building 191aa Hgh Pen GH Customs Service We are the direct factory which is located in zhengzhou, Henan ...

Passion Technology Development Limited
Verified Supplier

Henan

Quality Fat Burning and Bodybuilding Growth Hormone HGH Fragment 176-191 CAS 158861-67-7 With 5mg/Vial 10mg/vials for sale

Brand Name:Saichuang

Model Number:158861-67-7

Place of Origin:China

... 176-191 5mg/Vial 10mg/vials CAS 158861-67-7 Quick Details Product Name: HGH Fragment 176-191 Packing: 1. 2mg/vial, 10vial/box, bulk aluminum foil bag or on request 2. ...

Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
Verified Supplier

Hubei

Quality Melanotan II Hgh Growth Hormone Injection Skin Tanning Sexual Neuropeptide for sale

Brand Name:Diselbiotech

Model Number:MT2

Place of Origin:China

Skin Tanning and Sexual Human neuropeptide Peptide Powder Melanotan II / Mt 2 for Good Effecgt Product Description Name: Melanotan II Acetate (MT-II) CAS No.: 121062-08-6 Molecular Formula: C50H71N15O10 Molecular Weight: 1042.1932 Property: White powder ...

Wuhan Disel Biotechnology Co., Ltd.
Verified Supplier

Hubei

Quality 10iu/Vial  Human Growth  Hormone Supplements HGH Jintropin for Bodybuilding for sale

Brand Name:Holybiological

Model Number:96827-07-5

Place of Origin:China

...10/Vial Human Growth Hormone Supplements HGH Hygetropin for Anti-aging Product Details: Jintropin HGH CAS: 96827-07-5 Appearance: White Freeze dried Powder Specification: 10iu/vial,10vials/kit,100iu/kit ...

Hubei Holy Biological Co., Ltd.
Verified Supplier

Hubei

Quality CAS No 12629-01-5 Top Pure HGH Human Growth Hormone  Anti Aging Growth Hormone for sale

Brand Name:SGH

Model Number:CAS No: 12629-01-5

Place of Origin:China

Cas No. 12629-01-5 Size: 15iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

Jiangsu Biostronger Technology Co.,Ltd
Verified Supplier

Jiangsu

Quality GMP Certificated Hgh Human Growth Hormone For Muscle Mass Natural EPO Powder for sale

Brand Name:saizeng

Model Number:CasNo: 52170-72-6

Place of Origin:shanghai

...Bodybuilding Peptides For Muscle Mass EPO Powder GMP Certification jintroping hcg hgh 1. Company Info: Peak Biological Medicine Co., Ltd established in May.2012,which is a professional manufacturer ...

Shandong Chuangrui Chemical Technology Co., Ltd.
Verified Supplier

Shandong

Quality Ghrp 6 HGH Raw Steroid Powder 99% Purity Peptide Acetate For Bodybuilding for sale

Brand Name:Ghrp 6

Model Number:Ghrp 6

Place of Origin:China

...description Email:asaliu12138@gmail.com Skype:live:fa011024641926f2 GHRP-6 99% Purity HGH Human Growth Hormone Peptide Acetate For Bodybuilding​ Detailed Product Description Appearance: Powder Purity: 99.9% Production ...

Hubei KUKE Chemcial Co., Ltd
Verified Supplier

Hubei

Quality Peptide Powder Hgh Human Growth Hormone Ghrp -6 10mg/ Vial For Muscle Growth for sale

Brand Name:Global Chemical

Model Number:GHRP-2

Place of Origin:China

Basic Info Packing: Disguised Package or as Required Markets: Global Transport Package: Disguised Package or as Required Suitable for: Adult Purity: >98% Other Name: Ghrp-6 Acetate Function: for Weight Loss Storage: Keep Cold Form: White Frozen Dry Powder...

Global chemicals Co.,Ltd
Verified Supplier

Quality White Lyophilized Powder HGH in Yellow Top For Bodybuilding Meet Blood Standard for sale

Brand Name:Bodybiological

Model Number:Yellow Top HGH

Place of Origin:Hubei, China

... Yellow Top For Bodybuilding Meet Blood Standard Product Details: HGH Yellow Top 10iu/vial, 10vials/kit CAS: 96827-07-5 Appearance: White Freeze dried Powder Restful ...

Wuhan Body Biological Co.,Ltd
Verified Supplier

Hubei

Quality Taitropin Hgh Human Growth Hormone For Women Bodybuild Muscle Growth Hormone for sale

Brand Name:SR

Model Number:94-24-6

Place of Origin:China

...Taitropin Hgh Human Growth Hormone For Women Purity 99.9% 10IU/vial,10vials/kit Product Description: 100IU Taitropin ...

Shandong Shengri Chemical Co., Ltd.
Verified Supplier

Shandong

Quality Natural Effictive HGH Growth Hormone Peptide for sale

Brand Name:HBU

Model Number:12629-01-5

Place of Origin:CHINA

...) Description HGH 99.7% It has anabolic effects, may increase muscular physique, but also for people in childhood and adolescence, bone growth, and strengthen the tendons and increase the internal organs. Athletes using...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Quality Healthy HGH Human Growth Hormone CAS 10418-03-8 Winstrol Stanozolol Powder for sale

Brand Name:Rund

Model Number:10418-03-8

Place of Origin:China

Healthy Body Growth CAS 10418-03-8 Raw Steroid Powders Bulking Cycle Steroids Winstrol Stanozolol Quick Details: Product Name: Stanozolol Cas number: 10418-03-8 Molecular Formula: C22H36N2O Molecular Weight: 344.5392 Purity: 98% Drug Class: Injectable ...

3M Biotech Co., Ltd
Verified Supplier

Quality 99.5% Purity Hgh Growth Hormone Powder , Human Growth Steroids CAS 12629-01-5 HGH for sale

Brand Name:shinrezing

Model Number:12629-01-5

Place of Origin:China

Product Description Product name:Human (Growth) Peptide Hormone 1) Chemicalname:cb311;crecormon;humatrope;ly137998;norditropin;sj0011;OVINE S OMATOTROPIN;SOMATOTROPIN 2) CAS NO.:12629-01-5 3) Formula:C990H1529N263O299S7 4) Purity:99.5% 5) Color:white ...

Hubei Shinrezing Pharmaceutical Technology Co.,Ltd
Verified Supplier

Hubei

Quality China Best Peptides Manufacturer Supply Medicine Grade HGH Fragment 176-191 Lyophilized Powder for sale

Brand Name:Kafen

Model Number:albert@kafenbio.com

Place of Origin:China

...Quick detials: HGH Frag 176-191 Freeze-dried powder Product Name: HG Frag 176-191 Synonyms: HG Fragment ...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Quality HGH Fragment 176-191 Human Growth Peptides Healthy / Pharmaceutical Grade for sale

Brand Name:Yuancheng

Model Number:2mg/vial

Place of Origin:WUHAN

... Specification:2mg/vial Storage: Closed, below 2 ~ 8℃ preservation Fragment 176-191 as an Active HGH Truncated Peptide HGH fragment 176-191 is an analog of the growth hormone-releasing factor (GRF) which...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Quality Hgh Supplement Hgh For Men HGH injections Hgh For Sale Bodybuilding for sale

Categories:Growth Hormone Peptides

Country/Region:china

...Hgh Supplement Hgh For Men HGH injections Hgh For Sale Bodybuilding Quick Details: Name: HGH Fragment 176-191 Molecular Formula:C78H123N23O23S2 Molecular Weight:1815.08 Appearance:white powder Purity (HPLC):≥...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Quality Fragment 176-191 HGH Anabolic Steroids Hormones For Bodybuilding for sale

Brand Name:GB

Place of Origin:China

... youthful. But experts say that hope is unfounded. And worse, these products can be harmful. 2. HGH, produced by the pituitary gland, spurs growth in children and adolescents. It also helps to...

Hubei God bull Pharmaceutical Co.,Ltd
Site Member

Hubei

Quality 100mg HGH Human Growth Hormone for Injection for sale

Brand Name:OEM

Model Number:HGH

Place of Origin:China

...Description Posted under: HGH (Human Growth Hormone) Ansomone – a popular high-quality drug, which main active substance is recombinant growth ...

Beijing noxuan Kangle Biotechnology Co., Ltd.
Active Member

Quality Bodybuilding 100iu Ansomone Natural HGH Supplements Lyophilized Powder for sale

Brand Name:HGH

Model Number:ansomone 100iu

Place of Origin:China

... the form of lyophilized powder, this powder when activated with bacteriostatic water is used for HGH injections. Growth Hormone, the hormone that regulates aging in our bodies is naturally created by...

Hong Kong Zhicheng Chemical Factory
Site Member

Zhejiang

Quality Medicine Restful Sleep Taitropin HGH Human Growth Hormone Interferon Alpha 2b for Injection for sale

Brand Name:YIJING

Model Number:HGH

Place of Origin:SHANGHAI

... Growth Hormone Interferon Alpha 2b for Injection Restful Sleep Taitropin HGH Human Growth Hormone Improve The Sensitivity Of Peripheral Quick Details: Generic name: Recombinant Human Interferon ...

ShangHai ShuCan industrial co.. LTD
Active Member

Shanghai

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request