Sign In | Join Free | My chinaqualitycrafts.com
chinaqualitycrafts.com
Products
Search by Category
Home > Chemicals > Chemical Machinery Parts >

Sermorelin Ghrp 6

sermorelin ghrp 6

All sermorelin ghrp 6 wholesalers & sermorelin ghrp 6 manufacturers come from members. We doesn't provide sermorelin ghrp 6 products or service, please contact them directly and verify their companies info carefully.

Total 8440 products from sermorelin ghrp 6 Manufactures & Suppliers
Quality Sermorelin Peptides Injectable 86168-78-7 Human Growth Hormone Releasing Peptides for sale

Brand Name:Hongkong SaiChuang

Model Number:86168-78-7

Place of Origin:China

...Sermorelin Peptides for Muscle Gaining Injectable 86168-78-7 Sermorelin No.: 86168-78-7 Molecular Formula: C149H246N44O42S Molecular Weight: 3357.96 Purity (HPLC): 99.0%min. Single ...

Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
Verified Supplier

Hubei

Quality Enterprise Standard Weight Loss Peptides Ghrp 6 Peptide White Powder CAS 87616-84-0 for sale

Brand Name:shinrezing

Model Number:87616-84-0

Place of Origin:China

...Name;GHRP-6 Ghrp-6 Chemical Name;Growth hormon releasing peptide-6 Ghrp-6 CAS Number;87616-84-0 Ghrp-6 Molecular Formula;C46H56N12O6 Ghrp-6 Molecular Weight; 873.01 Ghrp-6 specification;5mg/vail or 10mg/vail *10vial/kit Ghrp-6 Assay;99.5% Ghrp-6 Appearance...

Hubei Shinrezing Pharmaceutical Technology Co.,Ltd
Verified Supplier

Hubei

Quality Men Body Building Hormone Peptide-6 GHRP-6 Growth Hormone with Anti Ageing Supplements for sale

Brand Name:HKYC

Model Number:GHRP-6

Place of Origin:China

... Detail: Unit Size :5 mg/vial ,10mg/vial Unit Quantity :1 Vial CAS NO. :87616-84-0 Synonyms :GHRP-6 Acetate Molecular Formula :C46H56N12O6 Molecular Weight :873.01 Sequence :H-His-D-Trp-Ala-Trp-D-Phe-Lys...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Quality Growth hormone Peptide Powder 2mg/vial Sermorelin GRF 1-29 CAS 86168-78-7 for sale

Brand Name:YIHAN

Model Number:Sermorelin--GRF(1-29)

Place of Origin:China

...Growth hormone Peptide Powder 2mg/vial Sermorelin GRF 1-29 CAS 86168-78-7 Quick Detail: Product Name Sermorelin Chemical Name Sermorelin Acetate,GRF 1-29, CAS Number 86168-78-7 Molecular Formula C149H246N44O42S Molecular Weight 3357...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Quality White Powder Sermorelin Human Growth Hormone Peptide Bodybuilding 86168-78-7 for sale

Brand Name:Pharmlab

Model Number:86168-78-7

Place of Origin:China

...99% Pharmaceutical Raw Materials White Powder Sermorelin Peptide Hormones Bodybuilding 86168-78-7 Quick Detail : Product Name Sermorelin Synonym Somatoliberin,Sermorelin CAS NO 86168-78-7 Molecular Formula C149H246N44O42S Molecular weight 3357.96 Purity 98...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Quality 99% Assay Protein Peptide Hormones 5mg/ Vials GHRP -2 CAS 158861-67-7 For Bodybuilding for sale

Brand Name:Global Chemical

Model Number:GHRP-2

Place of Origin:China

...99% Assay Protein Peptide Hormones 5mg/vials GHRP-2 For Bodybuilding CAS 158861-67-7 Quick Details: CAS: 158861-67-7 Molecular Formula: C42H50N8O5 Molecular weight: ...

Global chemicals Co.,Ltd
Verified Supplier

Quality Human Muscle Growth Peptides GHRP-2 CAS 158861-67-7 Raw White Powder 98.0% Min for sale

Brand Name:Saichuang

Model Number:158861-67-7

Place of Origin:China

...CAS 158861-67-7 Pralmorelin GHRP-2 Product Name:GHRP-2 (Pralmorelin),Growth Hormone Releasing Peptide-2 CAS: 158861-67-7 Molecular Formula: C42H50N8O5 Molecular Weight: 746.90 ...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Quality White Powder Growth Hormone Releasing Peptide10mg/Vial GHRP-2 / Pralmorelin for sale

Brand Name:YUANHANG

Model Number:158861-67-7

Place of Origin:CHINA

... known as KP 102 is a commercially synthesized, non-natural super-analog of the GHRP-6 which is capable of potent stimulatory effect on growth hormone secretion with slight stimulator effect ...

Yuanhang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Quality Top Purity 10mg/vial GHRP-2 Weight Loss Steroids Real Polypeptide Manufacturer for sale

Brand Name:Simeiquan

Model Number:10mg/vial

Place of Origin:China

... peptide) GHRP-2 Product Name:GHRP-2 GHRP-2 Alias: GHRP-2 Acetate;Pralmorelin; (DES-ALA3)-RELEASING PEPTIDE-2 GHRP-2 CAS: 158861-67-7 GHRP-2 M.F.: C45H55N9O6 GHRP-2 M.W.: 818.0 GHRP-2 Purity (HPLC): 98.0%min. GHRP-2 Appearance: White powder GHRP-2 Single...

Shenzhen Haiwen Biotechnology Co.,Ltd
Verified Supplier

Guangdong

Quality GHRP6 Human Growth Peptides Steroids Ghrp 6 87616-84-0 for Muscle Gaining for sale

Brand Name:HBYC

Model Number:HBYC

Place of Origin:China

...Safe Shipping GHRP6 Human Growth Peptide Steroid Ghrp 6 for Muscle Gaining GHRP 6 Basic Info Name Ghrp-6 Alias GHRP-6 Acetate CAS 87616-84-0 M. F C46H56N12O6 M. W 873.01 Purity (HPLC) 98.0%min. Appearance White powder Specification ...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Quality High Purity Muscle Building Peptides GHRP - 2  CAS 158861-67-7 , Injectable Peptides Bodybuilding for sale

Brand Name:TINGYI

Model Number:CAS: 158861-67-7

Place of Origin:China

...-D-PHE-LYS AMIDE;D-ALA-D-2-NAL-ALA-TRP-D-PHE-LYS-NH2;(DES-ALA3,D-ALA1,D-2-NAL2)-GHRP-6;(DES-ALA3)-GHRP-2;(DES-ALA3)-GROWTH HORMONE-RELEASING PEPTIDE-2;(DES-ALA3)-KP-102 CAS 158861-67-7 MF...

Chongqing Tingyi Biotechnology Co.,Ltd
Verified Supplier

Chongqing

Quality Sterile Filtered Growth Hormone Peptides White Lyophilized Powder Ghrp - 6 for sale

Brand Name:Shanghai Stero

Model Number:Ghrp - 6

Place of Origin:China

...Sterile Filtered White lyophilized Powder Growth Hormone Peptides Ghrp - 6 GHRP6 binds to receptors within the hypothalamus and the pituitary, which stimulates the release of ...

Shanghai Stero R&D Co,. Ltd
Verified Supplier

Shanghai

Quality CAS 158861-67-7 Injectable Peptides Raw Powder GHRP-6 For Fat Loss for sale

Brand Name:FILTER

Model Number:158861-67-7

Place of Origin:China

...Raw Material Peptide Powder CAS 158861-67-7 Ghrp-6 for Fat Loss Description Alias GHRP-2 Acetate; (DES-ALA3)-GROWTH E-RELEASING PEPTIDE-2 CAS 158861-67-7 M.F C45H55N9O6 M.W 818.0 Purity 99%min Appearance ...

Passion Technology Development Limited
Verified Supplier

Henan

Quality Ghrp 6 Human Growth Hormone Peptide For Losing Weight CAS 87616-84-0 for sale

Brand Name:Yihan

Model Number:87616-84-0

Place of Origin:China

.../10mg/vail Human Growth Hormone Steroid Peptide for Weight Loss GHRP-6 CAS 87616-84-0 Alias Pralmorelin,Ghrp-6 Specification Ghrp-6 5mg/10mg/Vial, 10vial/Kit Assay 99.0%min. Appearance White powder MF C46H56N12O6 MW...

Yihan Industrial Co.,Ltd.
Verified Supplier

Guangdong

Quality Fat Loss Growth Hormone Releasing Hexapeptide GHRP - 6 For Muscle Building for sale

Brand Name:HongKong Blue Universal Co., Limited.

Model Number:87616-84-0

Place of Origin:China

... Muscle Building 1.Quick Details: Skype: alan_9592 My Email : alan@sinosteroids.com Product Name GHRP-6 Synonyms Growth Hormone Releasing Hexapeptide Specification 5mg/vial,10vials/kit ; 10mg/vial,10vials/kit Appearance ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Quality CAS 158861-67-7 Fitness Growth Hormone Peptides Gh GHRP-2 For Fat Loss for sale

Brand Name:bodybiological

Model Number:158861-67-7

Place of Origin:Hubei, China

...CAS 158861-67-7 Fitness Growth Hormone Peptides Gh GHRP-2 For Fat Loss The half-life of GHRP-2 is quite short, though, with its peak occurring around 15 minutes after its administration or...

Wuhan Body Biological Co.,Ltd
Verified Supplier

Hubei

Quality Sermorelin Acetate Muscle Building Growth Hormone In Humans Peptides Sermorelin CAS 86168-78-7 GRF 1-29 for sale

Brand Name:SGH

Model Number:86168-78-7

Place of Origin:China

...- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, is an amidated synthetic 29-amino...

Jiangsu Biostronger Technology Co.,Ltd
Verified Supplier

Jiangsu

Quality Sell 99% Purity Weight Loss Peptides GHRP-2 Lyophilized Powder CAS:158861-67-7 for sale

Brand Name:Kafen

Model Number:158861-67-7

Place of Origin:China

... White powder Related substance: Total Impurities(%) < 2.0% Acetate content: < 15.0% Bacterial Endotoxins: <5 IU/mg 2.Product Description: GHRP-2 is a synthetic agonist of ghrelin, the newly-discovered gut peptide which binds secretagogue receptor. Ghrelin...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Quality 99% Assay Protein Peptide Hormones 5mg/vials GHRP-2 For Bodybuilding CAS 158861-67-7 for sale

Brand Name:Muscle Man

Model Number:CAS:158861-67-7

Place of Origin:Hunan,China

...99% Assay Protein Peptide Hormones 5mg/vials GHRP-2 For Bodybuilding CAS 158861-67-7 Quick Details: CAS: 158861-67-7 Molecular Formula: C42H50N8O5 Molecular weight: ...

Zhuzhou Interial Biotechnology Co., Ltd
Site Member

Hunan

Quality GHRP-6 Develop Human Growth Hormone Stimulate GH Release Top Quality HGH Wholesale for sale

Place of Origin:Shen Zhen of China

Brand Name:GHRP

Model Number:HGH-29

... Growth hormone releasing hexa peptide (GHRP 6) is one of several synthetic met-enkephalin analogs that include unnatural D-amino acids, were developed ...

Hongkong HW Biotech Co.,Ltd.
Site Member

Yunnan

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request