Sign In | Join Free | My chinaqualitycrafts.com
chinaqualitycrafts.com
Products
Search by Category
Home > Chemicals > High Polymers >

Sermorelin Ghrp 6

sermorelin ghrp 6

All sermorelin ghrp 6 wholesalers & sermorelin ghrp 6 manufacturers come from members. We doesn't provide sermorelin ghrp 6 products or service, please contact them directly and verify their companies info carefully.

Total 16027 products from sermorelin ghrp 6 Manufactures & Suppliers
Quality Supply High Quality 100% Purity GHRP-6 Powder Peptides Powder for Bodybuilding for sale

Brand Name:Yuanhang

Model Number:Peptides

Place of Origin:China

.../vial,10mg/vial Grade Pharmaceutical Grade Appearance White Powder Description: Growth Hormone Releasing Peptide-6 or GHRP-6 is basically a hgH secretagoue, which has the potential to facilitate the effective increase the levels...

Yuanhang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Quality Enterprise Standard Weight Loss Peptides Ghrp 6 Peptide White Powder CAS 87616-84-0 for sale

Brand Name:shinrezing

Model Number:87616-84-0

Place of Origin:China

...Name;GHRP-6 Ghrp-6 Chemical Name;Growth hormon releasing peptide-6 Ghrp-6 CAS Number;87616-84-0 Ghrp-6 Molecular Formula;C46H56N12O6 Ghrp-6 Molecular Weight; 873.01 Ghrp-6 specification;5mg/vail or 10mg/vail *10vial/kit Ghrp-6 Assay;99.5% Ghrp-6 Appearance...

Hubei Shinrezing Pharmaceutical Technology Co.,Ltd
Verified Supplier

Hubei

Quality Ghrp2 Hormone Human Growth Peptides CAS 158861-67-7 GHRP -2 Acetate Powder for sale

Brand Name:Saichuang

Model Number:158861-67-7

Place of Origin:Wuhan,Hubei

... ghrelin, it is synergistic with endogenous releasing-ormone (GHRP) as well as with synthetic GHRH analogues such as Sermorelin or GRF(1-29). Whereas GHRP-2 and other ghrelin analogues increase the number of somatotropes...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Quality White Powder Sermorelin Human Growth Hormone Peptide Bodybuilding 86168-78-7 for sale

Brand Name:Pharmlab

Model Number:86168-78-7

Place of Origin:China

...99% Pharmaceutical Raw Materials White Powder Sermorelin Peptide Hormones Bodybuilding 86168-78-7 Quick Detail : Product Name Sermorelin Synonym Somatoliberin,Sermorelin CAS NO 86168-78-7 Molecular Formula C149H246N44O42S Molecular weight 3357.96 Purity 98...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Quality Sermorelin GRF 1-29 Muscle Buidling Steroids CAS 804475-66-9 White Lyophilized Powder for sale

Brand Name:HKYC

Model Number:218949-48-5

Place of Origin:China

Product Name: Tesamorelin Molecular Formula: C221H366N72O67S Molecular Weight: 5135.77794 PubChem: CID 44201342 Synonyms: Hex-hGRF, ThGRF(1-44), TH-9507, (Hexenoyl trans-3)-hGRF(1-44)-NH2 Sequence (Three-Letter Code): trans-3-hexenoyl-Tyr-Ala-Asp-Ala-Ile-...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Quality 99% Assay Protein Peptide Hormones 5mg/ Vials GHRP -2 CAS 158861-67-7 For Bodybuilding for sale

Brand Name:Global Chemical

Model Number:GHRP-2

Place of Origin:China

...99% Assay Protein Peptide Hormones 5mg/vials GHRP-2 For Bodybuilding CAS 158861-67-7 Quick Details: CAS: 158861-67-7 Molecular Formula: C42H50N8O5 Molecular weight: ...

Global chemicals Co.,Ltd
Verified Supplier

Quality White Lyophilized Powder Growth Hormone Peptides Ghrp-6 5mg / 10mg per Vial 99% Purity for sale

Brand Name:Yvonne

Model Number:188627-80-7

Place of Origin:China

...Growth Hormone Peptide White Lyophilized Powder Ghrp-6 5mg / 10mg per Vial 99% Purity 1 . GHRP-6 Basic Information Product Name GHRP-6 Column Sinochrom ODS-BP, 4.6*250mm, 5um Solvent A 0.1%Trifluoroacetic in 100% Acetonitrile Solvent B 0.1%Trifluoroacetic ...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hubei

Quality Top Purity 10mg/vial GHRP-2 Weight Loss Steroids Real Polypeptide Manufacturer for sale

Brand Name:Simeiquan

Model Number:10mg/vial

Place of Origin:China

... peptide) GHRP-2 Product Name:GHRP-2 GHRP-2 Alias: GHRP-2 Acetate;Pralmorelin; (DES-ALA3)-RELEASING PEPTIDE-2 GHRP-2 CAS: 158861-67-7 GHRP-2 M.F.: C45H55N9O6 GHRP-2 M.W.: 818.0 GHRP-2 Purity (HPLC): 98.0%min. GHRP-2 Appearance: White powder GHRP-2 Single...

Shenzhen Simeiquan Biotechnology Co., Ltd.
Verified Supplier

Guangdong

Quality GHRP6 Human Growth Peptides Steroids Ghrp 6 87616-84-0 for Muscle Gaining for sale

Brand Name:HBYC

Model Number:HBYC

Place of Origin:China

...Safe Shipping GHRP6 Human Growth Peptide Steroid Ghrp 6 for Muscle Gaining GHRP 6 Basic Info Name Ghrp-6 Alias GHRP-6 Acetate CAS 87616-84-0 M. F C46H56N12O6 M. W 873.01 Purity (HPLC) 98.0%min. Appearance White powder Specification ...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Quality High Purity Muscle Building Peptides GHRP - 2  CAS 158861-67-7 , Injectable Peptides Bodybuilding for sale

Brand Name:TINGYI

Model Number:CAS: 158861-67-7

Place of Origin:China

...-D-PHE-LYS AMIDE;D-ALA-D-2-NAL-ALA-TRP-D-PHE-LYS-NH2;(DES-ALA3,D-ALA1,D-2-NAL2)-GHRP-6;(DES-ALA3)-GHRP-2;(DES-ALA3)-GROWTH HORMONE-RELEASING PEPTIDE-2;(DES-ALA3)-KP-102 CAS 158861-67-7 MF...

Chongqing Tingyi Biotechnology Co.,Ltd
Verified Supplier

Chongqing

Quality Human Growth Hormone Releasing Peptide , GHRP 6 Peptide 5mg / Vial CAS 87616-84-0 for sale

Brand Name:YIHAN

Model Number:GHRP 6

Place of Origin:China

...Human Growth Hormone Releasing Peptide , GHRP 6 Peptide 5mg / Vial CAS 87616-84-0 Synonyms: GHRP-6 CAS NO.: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular weight: 873.01 Molar Mass: 873.014 ...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Quality Sterile Filtered Growth Hormone Peptides White Lyophilized Powder Ghrp - 6 for sale

Brand Name:Shanghai Stero

Model Number:Ghrp - 6

Place of Origin:China

...Sterile Filtered White lyophilized Powder Growth Hormone Peptides Ghrp - 6 GHRP6 binds to receptors within the hypothalamus and the pituitary, which stimulates the release of ...

Shanghai Stero R&D Co,. Ltd
Verified Supplier

Shanghai

Quality Ghrp 6 Human Growth Hormone Peptide For Losing Weight CAS 87616-84-0 for sale

Brand Name:Yihan

Model Number:87616-84-0

Place of Origin:China

.../10mg/vail Human Growth Hormone Steroid Peptide for Weight Loss GHRP-6 CAS 87616-84-0 Alias Pralmorelin,Ghrp-6 Specification Ghrp-6 5mg/10mg/Vial, 10vial/Kit Assay 99.0%min. Appearance White powder MF C46H56N12O6 MW...

Yihan Industrial Co.,Ltd.
Verified Supplier

Guangdong

Quality 2mg 5mg/Vial Bodybuilding Peptides , Bulking Cycle Polypeptide Sermorelin for sale

Brand Name:Filter

Model Number:86168-78-7

Place of Origin:China

...Sermorelin 2mg/5mg Vial Sermorelin for Bulking Cycle CAS: 86168-78-7 Polypeptide Sermorelin 2mg/5mg Vial Sermorelin for Bulking Cycle CAS: 86168-78-7 Product Description Polypeptide Sermorelin 2mg 5mg Vial Sermorelin for Bulking Cycle Sermorelin Sermorelin...

Zhengzhou Filter Biotechnology Co.,Ltd
Verified Supplier

Henan

Quality Fat Loss Growth Hormone Releasing Hexapeptide GHRP - 6 For Muscle Building for sale

Brand Name:HongKong Blue Universal Co., Limited.

Model Number:87616-84-0

Place of Origin:China

... Muscle Building 1.Quick Details: Skype: alan_9592 My Email : alan@sinosteroids.com Product Name GHRP-6 Synonyms Growth Hormone Releasing Hexapeptide Specification 5mg/vial,10vials/kit ; 10mg/vial,10vials/kit Appearance ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Quality CAS 86168-78-7 GRF 1-29 Growth Hormone For Bodybuilding Sermorelin Acetate Muscle Gain for sale

Brand Name:SGH

Model Number:86168-78-7

Place of Origin:China

...- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, is an amidated synthetic 29-amino...

Jiangsu Biostronger Technology Co.,Ltd
Verified Supplier

Jiangsu

Quality Sell 99% Purity Weight Loss Peptides GHRP-2 Lyophilized Powder CAS:158861-67-7 for sale

Brand Name:Kafen

Model Number:158861-67-7

Place of Origin:China

... White powder Related substance: Total Impurities(%) < 2.0% Acetate content: < 15.0% Bacterial Endotoxins: <5 IU/mg 2.Product Description: GHRP-2 is a synthetic agonist of ghrelin, the newly-discovered gut peptide which binds secretagogue receptor. Ghrelin...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Quality 158861-67-7 Releasing Bodybuilding Peptide GHRP-2 Acetate Steroids GHRP-6 for sale

Brand Name:Grand Uni or OEM

Model Number:CAS:158861-67-7

Place of Origin:China

... Peptide GHRP-2 Acetate Steroids GHRP-6 Quck Details: GHRP-2 CAS: 158861-67-7 GHRP-2Sequence: H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 GHRP-2 Formula: C45H55N9O6 GHRP-2Molecular weight: 817.9 GHRP-2Peptide purity: > 98.0% GHRP-2Appearance: White powder GHRP...

GRAND UNIVERSE INDUSTRIAL LIMITED
Verified Supplier

Guangdong

Quality Human Growth Hormone Peptide GHRP-6 Freeze Dried Powder 5mg/vial for Muscle Building for sale

Brand Name:LSW

Model Number:87616-84-0

Place of Origin:China

... Dried Powder 5mg/vial for Muscle Building Quick Details: Product name:GHRP-6 Other name:GHRP-6 Acetate;His(1)-lys(6)-ghrp;GH-Releasing peptide CAS:87616-84-0 MF:C46H56N12O6 MW:873.01 Purity:.98%min...

Wuhan Lianshangwang Technology Co.,Ltd
Verified Supplier

Hubei

Quality GHRP-6 Develop Human Growth Hormone Stimulate GH Release Top Quality HGH Wholesale for sale

Place of Origin:Shen Zhen of China

Brand Name:GHRP

Model Number:HGH-29

... Growth hormone releasing hexa peptide (GHRP 6) is one of several synthetic met-enkephalin analogs that include unnatural D-amino acids, were developed ...

Hongkong HW Biotech Co.,Ltd.
Site Member

Yunnan

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request