Sign In | Join Free | My chinaqualitycrafts.com
chinaqualitycrafts.com
Products
Search by Category
Home > Health & Medical > Extract > Plant Extracts >

Sermorelin Ghrp 6

sermorelin ghrp 6

All sermorelin ghrp 6 wholesalers & sermorelin ghrp 6 manufacturers come from members. We doesn't provide sermorelin ghrp 6 products or service, please contact them directly and verify their companies info carefully.

Total 5438 products from sermorelin ghrp 6 Manufactures & Suppliers
Quality GHRP-2 Sermorelin Lyophilized Inject To Promote Children Grow Taller MGF MT-1 for sale

Brand Name:SMQ

Model Number:Sermorelin

Place of Origin:China mainland

...Sermorelin Lyophilized Inject To Promote Children Grow Taller Detailed Product Description Product Name: Sermorelin Appearance: Lyophilized powder CAS NO.: 86168-78-7 Purity: 99% Alias: Sermorelin Application: Peptide Drum Quick Detail: Sermorelin Acetate ...

Shenzhen Haiwen Biotechnology Co.,Ltd
Verified Supplier

Guangdong

Quality 98% High Purity Bio Identical Muscle Building Peptides Sermorelin White Color for sale

Brand Name:TINGYI

Model Number:CAS: 86168-78-7

Place of Origin:CHINA

...98% High Purity Bio-identical Growth Hormone Peptide Sermorelin (2 mg/vial) Description: Sermorelin (INN) (trade name is Geref), also known as GHRH (1-29), is a growth hormone- releasing hormone (...

Chongqing Tingyi Biotechnology Co.,Ltd
Verified Supplier

Chongqing

Quality Enterprise Standard Weight Loss Peptides Ghrp 6 Peptide White Powder CAS 87616-84-0 for sale

Brand Name:shinrezing

Model Number:87616-84-0

Place of Origin:China

...Name;GHRP-6 Ghrp-6 Chemical Name;Growth hormon releasing peptide-6 Ghrp-6 CAS Number;87616-84-0 Ghrp-6 Molecular Formula;C46H56N12O6 Ghrp-6 Molecular Weight; 873.01 Ghrp-6 specification;5mg/vail or 10mg/vail *10vial/kit Ghrp-6 Assay;99.5% Ghrp-6 Appearance...

Hubei Shinrezing Pharmaceutical Technology Co.,Ltd
Verified Supplier

Hubei

Quality Pharmaceutical Powder Polypeptides For Muscle Building Sermorelin Acetate Hydrate for sale

Brand Name:YIHAN

Model Number:Sermorelin

Place of Origin:hina

... Building Sermorelin Acetate Hydrate Quick detail Sermorelin 2mg (GRF 1-29) Peptide Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Quality CAS158861-67-7  5mg / Vial Peptide Ghrp 6 , 99% Purity Research Chemicals Peptides for sale

Brand Name:bodybiological

Model Number:158861-67-7

Place of Origin:Hubei, China

...Research Chemical 99% Purity CAS158861-67-7 Peptides Ghrp 6 10mg/vial Basic Information for GHRP-6: Synonyms: GHRP-6 CAS NO.: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular weight: 873.01 Molar Mass: 873.014 ...

Wuhan Body Biological Co.,Ltd
Verified Supplier

Hubei

Quality CAS 87616-84-0 GHRP 6 Acetate For Gaining Muscles 2mg/vial  peptide 99% purity for sale

Brand Name:Top Pharm

Model Number:87616-84-0

Place of Origin:China

... for gaining muscles CAS number: 87616-84-0 2mg/vial white powder Product Name GHRP-6 Acetate Sequence Cas No. 87616-84-0 Molecular Formula C46H56N12O6 Molecular Weight 873.01 Purity (HPLC) ...

TOP PHARM CO.,LIMITED
Verified Supplier

Quality Legal Growth Hormone Releasing Peptide GHRP-6/-2 GHRP-6220vial For Muscle Growth Cas 87616-84-0 for sale

Brand Name:Saichuang

Model Number:87616-84-0

Place of Origin:China

... 99% min Usage Peptides; Hormones and Regulation of Endocrine Function of D Appearance White powder Property GHRP-6, GHRP-2, GHRP2, GHRP6, ghrp HGH fragment177-191, HGH fragment 176-191AOD, EGF, MT-1, MT-2,

Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
Verified Supplier

Hubei

Quality Sermorelin Acetate Peptides Muscle Growth Peptides CAS 86168-78-7 For Building Muscle for sale

Brand Name:Saichuang

Model Number:86168-78-7

Place of Origin:China

... Name:Sermorelin Acetate,GRF 1-29 Alias:Somatoliberin,Sermorelin ,Sermorelinum,Sermorelina,Sermoreline CAS No.: 86168-78-7 Molecular Formula: C149H246N44O42S Sermorelin Molecular Weight: 3357.96 Sermorelin Purity (HPLC): 98.0%min. Sermorelin Appearance...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Quality Sermorelin CAS 86168-78-7 Muscle Building Sterods Growth Hormone Releasing Hormones for sale

Brand Name:Keray

Model Number:86168-78-7

Place of Origin:China

... Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate Product Name: Sermorelin Unit size: 2 mg/vial CAS NO.: 86168-78-7 Synonyms: GRF 1-29...

Shenzhen Keray Biotech Co., Ltd
Verified Supplier

Guangdong

Quality 2mg 5mg/Vial Bodybuilding Peptides , Bulking Cycle Polypeptide Sermorelin for sale

Brand Name:Filter

Model Number:86168-78-7

Place of Origin:China

...Sermorelin 2mg/5mg Vial Sermorelin for Bulking Cycle CAS: 86168-78-7 Polypeptide Sermorelin 2mg/5mg Vial Sermorelin for Bulking Cycle CAS: 86168-78-7 Product Description Polypeptide Sermorelin 2mg 5mg Vial Sermorelin for Bulking Cycle Sermorelin Sermorelin...

Passion Technology Development Limited
Verified Supplier

Henan

Quality Lyophilized Powder Sermorelin 2mg for Body Building CAS 86168-78-7 for sale

Brand Name:YIHAN

Model Number:Sermorelin 2mg

Place of Origin:CHINA

...Lyophilized Powder Sermorelin 2mg for Body Building CAS 86168-78-7 Quick detail: Product Name Sermorelin Other Name SERMORELIN;SERMORELIN ACETATE;GROWTH HOR RELEASING FACTOR (1-29), AMIDE, GRF (1-29) NH2 Original China CAS 86168-78...

Yihan Industrial Co.,Ltd.
Verified Supplier

Guangdong

Quality Sermorelin Acetate Muscle Building Growth Hormone In Humans Peptides Sermorelin CAS 86168-78-7 GRF 1-29 for sale

Brand Name:SGH

Model Number:86168-78-7

Place of Origin:China

...- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, is an amidated synthetic 29-amino...

Jiangsu Biostronger Technology Co.,Ltd
Verified Supplier

Jiangsu

Quality Nature Fat Loss and Anti Aging Polypeptide Hormones Ghrp-2 Growth Hormone Releasing Peptide Ghrp-2 for sale

Brand Name:Holybiological

Model Number:WhatsApp:+8613545014917

Place of Origin:China

...Nature Fat Loss and Anti Aging Polypeptide Hormones Ghrp-2 Growth Hormone Releasing Peptide Ghrp-2 Name GHRP-2 (Pralmorelin) (5mg/vial,10vials/kit) Other name GHRP-2 Acetate; (DES-ALA3)-GROWTH HORMONE-RELEASING PEPTIDE-2 Appearance White powder...

Hubei Holy Biological Co., Ltd.
Verified Supplier

Hubei

Quality CAS86168-78-7 Human Growth Peptides Sermorelin Bodybuilding For Muscle Growth for sale

Brand Name:Pharma Grade

Model Number:86168-78-7

Place of Origin:Zhejiang,China

...Sermorelin CAS86168-78-7 human growth Peptides for Muscle growth Polypeptides are compounds in which alpha-amino ...

HONGKONG RONGXIN BIO-TECH CO.,LTD
Verified Supplier

Shaanxi

Quality High Purity Muscle Building Peptides GHRP - 2 Medical Grade 87616-84-0 High Purity Injectable Peptides Bodybuilding for sale

Brand Name:Peptides GHRP-2

Model Number:Peptides GHRP-2

Place of Origin:China

...Basic Info: Product name: GHRP-2 (GHRP-2 Acetate ) Synonym: Pralmorelin [INN]; D-Alanyl-3-(2-naphthalenyl)-D-alanyl-L-alanyl-L-tryptophyl-D-phenylalanyl-L-lysinamide; GHRP 2; CAS: 158861-67-7 MF: C45H55N9O6 MW: 817.9749 Purity: 98% Appearance: White powder...

Guangzhou Lishen Healthcare Co.,Ltd
Verified Supplier

Guangdong

Quality High Purity Muscle Growth Peptides , Sermorelin Acetate Bodybuilding GRF 1-29 for sale

Brand Name:Hongxi Pharm

Model Number:SARMs Powder

Place of Origin:HongKong/China

... Peptide Hormones Bodybuilding Freeze-Dried Powder GRF (1-29) Product Name Sermorelin Acetate Also known as Sermorelin Appearance Freeze-Dried White Powder Standard Pharmaceutical Purity Not Lower Than 98.00% Application Type ...

Hongxi International Pharmaceutical Co., Ltd.
Verified Supplier

Hongkong

Quality Pharmaceutical Growth Hormone Peptides GHRP-2 5MG Releasing Peptide For Muscle Gain and Anti Aging for sale

Brand Name:BestSteroid

Model Number:158861-67-7

Place of Origin:Hubei,China

... Releasing Peptide For Muscle Gain and Anti Aging GHRP-2 Basic Info GHRP-2 (Pralmorelin) Alias: GHRP-2 Acetate CAS: 158861-67-7 M.F.: C42H50N8O5 M.W.: 746.90 Purity (HPLC): 99.0%min. Appearance: White powder Single ...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Quality 5mg / Vial Ghrp 6 Peptides , Human Growth Hormone Hgh Top Pure Muscle Building Injection for sale

Brand Name:TY-Chemical

Model Number:87616-84-0

Place of Origin:China

... Top Pure Muscle Building Injection Our Safe through Customs Strengths: 1.Making sure GHRP-6 how is going to pass customs? GHRP-6 how to safely pass the customs problem, you don't have to worry...

Guangzhou Teng yue Chemical Co., Ltd.
Verified Supplier

Guangdong

Quality SBJ Effective Great White Powder Peptides Sermorelin(2mg/vial) To Gain Muscle for sale

Brand Name:SBJ

Model Number:Sermorelin

Place of Origin:China

...: 98.0% min. Appearance: White lyophilized powder 2.Description: GH-releasing peptide-6 (GHRP-6) is a potent GH secretagogue that releases GH by uncertain mechanisms. Sermorelin is a well tolerated analogue of GHRH which is suitable for...

Zhuhaishi Shuangbojie Technology Co., Ltd.
Active Member

Guangdong

Quality 99.% purity Sermorelin CAS 86168-78-7 Polypeptides Pharmaceutical Hormone Powder For Body Building for sale

Brand Name:yijing

Model Number:gclb3e@yccreate.com

Place of Origin:china

...99% Sermorelin CAS 86168-78-7 Polypeptide Hormones Pharmaceutical raw materials white powder For Body Building Basic View: H-...

ShangHai YiJing Industrial Co,LTD
Active Member

Shanghai

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request